PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02176.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 813aa    MW: 90528 Da    PI: 6.3819
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02176.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.69.8e-23155256199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                              f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++ ++W++++i+r++++r++l++GW+ Fv++++L +gD +
  Rsa1.0_02176.1_g00003.1 155 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAF 239
                              99*****************************7333.34459********************************************* PP

                              EEEE-SSSEE..EEEEE-S CS
                       B3  81 vFkldgrsefelvvkvfrk 99 
                              +F   + +++el+v+v+r+
  Rsa1.0_02176.1_g00003.1 240 IFL--RGENGELRVGVRRA 256
                              ***..449999*****996 PP

2Auxin_resp120.51.3e-39281363183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp+rW +SkWrsLk
  Rsa1.0_02176.1_g00003.1 281 AWHAISTGTMFSVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPTRWAKSKWRSLK 363
                              89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-40150284IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-40150270IPR015300DNA-binding pseudobarrel domain
CDDcd100171.32E-20153255No hitNo description
PfamPF023621.4E-20155256IPR003340B3 DNA binding domain
SMARTSM010194.1E-22155257IPR003340B3 DNA binding domain
PROSITE profilePS5086311.42155257IPR003340B3 DNA binding domain
PfamPF065071.2E-36281363IPR010525Auxin response factor
PfamPF023099.9E-11684775IPR033389AUX/IAA domain
SuperFamilySSF542773.43E-11689769No hitNo description
PROSITE profilePS5174524.61690772IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MASSEVSMRG NRGGDNFNGD STTETRNVSV TGEGQKGHSN RVVDAEAALY RELWHACAGP  60
LVTVPKQDDR VFYFPQGHIE QVEASTNQAA EQQMPLYDLP SKLLCRVINV DLKAEVDSDE  120
VYAQITLLPE AIQDENAIEK ETPPPPPPKF QVHSFCKTLT ASDTSTHGGF SVLRRHADEC  180
LPPLDMSRQP PTQELVAKDL HANEWRFRHI FRGQPRRHLL QSGWSVFVSS KRLVAGDAFI  240
FLRGENGELR VGVRRAMRQQ GNVPSSVISS HSMHLGVLAT AWHAISTGTM FSVYYKPRTS  300
PSEFIVPFDQ YMESVKNNYS IGMRFKMRFE GEEAPEQRFT GTIVGIEDSD PTRWAKSKWR  360
SLKVRWDETS SIPRPDRVSP WKLEPALAPP ALSSSMASKD PLPASGLTRV FQGQEYPTLR  420
TKHSESVECD APESSVVWQS SADDDKVDVA SASKRYENWM SSGRHEPSYT DLLSGFGANI  480
DPSRGHQIPF YDHSSLPSVA ANKFLGDRDG KFDYFANQWQ MMQSGLSLKL HESPKVPAAS  540
DSSFQGRGSA KYGEYPVLHS LTTENAGGNW PIRPRALNYY EEAVHAQAQA QAQAREHVTQ  600
RPAMVEEETA KSRDGNCRLF GIALVNNVNG TDSPRNNFNG TAGLTQVASP KVQDLSDQSK  660
STTDHREQGR PFQVKNPHLK DVHTKSNSSR SCTKVHKQGI ALGRSVDLSK FQNYEELIAE  720
LDSMFEFNGE LMAPKKDWLI VYTDAEDDMM LVGDDPWQEF CGMVRKISIY TKEEVRKMNP  780
GTLSCRSEEE AVVGEGSDPK DAKSASNPSL SSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1804838518354Auxin response factor 1
4ldw_A1e-1804838518354Auxin response factor 1
4ldv_A1e-1804838518354Auxin response factor 1
4ldx_B1e-1804838518354Auxin response factor 1
4ldx_A1e-1804838518354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794610.0JN979461.1 Brassica rapa subsp. pekinensis auxin response factor 2-3 (ARF2-3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201006.20.0auxin response factor 2
RefseqNP_851244.10.0auxin response factor 2
RefseqNP_974980.10.0auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A078DDD50.0A0A078DDD5_BRANA; Auxin response factor
STRINGAT5G62000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2